DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and Prmt7

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001014175.1 Gene:Prmt7 / 361402 RGDID:1304869 Length:693 Species:Rattus norvegicus


Alignment Length:331 Identity:83/331 - (25%)
Similarity:132/331 - (39%) Gaps:74/331 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EGKDSDYFQSYSRLETHMNMLRDSVR----MQAFRDAI--VQDGGLFQDKIVLDVGCGTGILSLF 71
            |.:..||.|..:| .::.:||.|..|    .|..|.|:  |:|.|  |..:|||:|.|||:||:.
  Rat    20 EDEHYDYHQEIAR-SSYADMLHDKDRNIKYYQGIRAAVSRVKDKG--QKALVLDIGTGTGLLSMM 81

  Fly    72 AAEAGASKVIAVEC-TDIADIAEEIIRDNQKENVVKVV-KGLVEQVELPDGIE--KVDIIVSEWM 132
            |..|||....|||. ..:|:.|.:|:..|...:.:||: |...|....|||..  :.:|:|:|..
  Rat    82 AVTAGADFCYAVEVFKPMAEAAVKIVEKNGFSDKIKVINKHSTEVTVGPDGDLPCRANILVTELF 146

  Fly   133 GNALYMEAMINSVLFARDKWLTRGGRILPSTGNLWLMGAYDPHRRT--------------NLNFW 183
            ...|..|..:.|...|....:......:             |||.|              |..|.
  Rat   147 DTELIGEGALPSYEHAHKHLVQEDCEAV-------------PHRATVYAQLVESKRMWSWNKLFP 198

  Fly   184 CNVE-GIDMGCVRKPFSQE-----PLVEFVPIQQ-------LLTDECFIHSTNLAVARNQPVEFQ 235
            ..|: |:....:..|...|     |.|..:.:.|       :|:|...:.|.:.:...:......
  Rat   199 VRVQTGLGEQLIIPPSELERCPGAPSVYDIQLNQVSPADFTVLSDVLPMFSVDFSKQVSSSAACH 263

  Fly   236 SNFQLKVMRTGIINMLVLYFDV-LFPSGKSNKSVSLTTSPHSPWT-----------HWEQTVLHL 288
            |. |...:.:|...:::.::|: :.|.||    :..|.:|.  |.           ||.|.|..|
  Rat   264 SK-QFVPLASGQAQVVLSWWDIEMDPEGK----IKCTMAPF--WAQTDPQELQWRDHWMQCVYFL 321

  Fly   289 --DEPL 292
              :||:
  Rat   322 PQEEPI 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 45/141 (32%)
Prmt7NP_001014175.1 AdoMet_MTases 37..>188 CDD:302624 49/165 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.