DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and H20J04.9

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001022224.1 Gene:H20J04.9 / 3565191 WormBaseID:WBGene00044310 Length:268 Species:Caenorhabditis elegans


Alignment Length:197 Identity:37/197 - (18%)
Similarity:70/197 - (35%) Gaps:52/197 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RMQAFRDAIVQDGGLFQDKIVLDVGCGTG---ILSLFAAEAGASKVIAVECTD----------IA 89
            :.:...:.:|:...:.:|..:.::|.|.|   .:.....:.|...|..||.:.          :.
 Worm    44 KSRRLNEKVVEKMDIGKDDFLFEIGFGRGDAMKMCFDRVKDGRGMVFGVERSGYMNERAIKRFVL 108

  Fly    90 DIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMIN----------- 143
            :|||   .|..:.:....::.|....:|.:.:..||:..      .|...|::|           
 Worm   109 EIAE---TDKIRIDSAVDLRNLPYPTDLFNHVFHVDLFY------FLQQNALVNINRELLRVLKP 164

  Fly   144 ------SVLFARDKWLTRGGRILPSTGNLWLMGAYDPHRRTNLNFWCNVEGIDMGCVRKPFSQEP 202
                  .:.|.|.|.||. .|||..  |.|     ||.|    ..|. :|..:...|:..:.::|
 Worm   165 GGTLICGMQFDRLKKLTE-NRILEE--NQW-----DPMR----YLWA-LETAEFSDVKINYHKDP 216

  Fly   203 LV 204
            .:
 Worm   217 QI 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 27/152 (18%)
H20J04.9NP_001022224.1 Methyltransf_25 66..166 CDD:379312 18/108 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.