DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and Art8

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster


Alignment Length:312 Identity:119/312 - (38%)
Similarity:169/312 - (54%) Gaps:15/312 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASKVIAV 83
            ||..|..||.|..||:|..|.:|:.:||:.:..||:||||:|||.||||||.|.|:|||..|.||
  Fly     5 YFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAV 69

  Fly    84 ECTDIA-DIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMINSVLF 147
            |.:::| .:|.::|.||...|||||::..||:..||...||||||||||||..|..|.|::|||.
  Fly    70 EASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVLL 134

  Fly   148 ARDKWLTRGGRILPSTGNLWLMGAYDPHRRTNLNFWCNVEGIDMGC----VRKPFSQEPLVEFVP 208
            ||||:|..||.:.||...:::.....|   :..:.|.||:||.|..    :|...|..|.:..:.
  Fly   135 ARDKFLKEGGLLFPSECTIFVAPCSVP---SLFDDWHNVDGIKMDTFARKLRTQKSSRPEITQLN 196

  Fly   209 IQQLLTDECFIHSTNLA-VARNQPVEFQSNFQLKVMRTGIINMLVLYFDVLFPSGKSNKSVSLTT 272
            .|.||.:....|..||. |..:.....|....:...:.|......::|||.||    .:...|:|
  Fly   197 PQDLLHEGVVFHWMNLLDVEASDLDSIQFKEVITAQKAGNHQGFCIWFDVQFP----GEDFVLST 257

  Fly   273 SPHSPWTHWEQTVLHLDEPLYVRIRDR--VRGVLAMTPTGQDGRGMNFDLHI 322
            ||.||.|||:|.|:.|.|.....:.::  :...:.|..:..|.|..|.::.:
  Fly   258 SPLSPPTHWKQCVVVLPEESCENLEEKSPIAFQITMKRSAADMRKYNLEVDL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 71/132 (54%)
Art8NP_609478.1 SmtA 1..244 CDD:223574 97/241 (40%)
Methyltransf_18 40..147 CDD:289607 61/106 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440090
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1503
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.