DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and PRMT1

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001527.3 Gene:PRMT1 / 3276 HGNCID:5187 Length:371 Species:Homo sapiens


Alignment Length:310 Identity:128/310 - (41%)
Similarity:203/310 - (65%) Gaps:5/310 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASKVIAV 83
            ||.||:....|..||:|.||...:|:::..:..||:||:|||||.|||||.:|||:|||.|||.:
Human    53 YFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGI 117

  Fly    84 ECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMINSVLFA 148
            ||:.|:|.|.:|::.|:.::||.::||.||:||||  :||||||:|||||..|:.|:|:|:||:|
Human   118 ECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVLYA 180

  Fly   149 RDKWLTRGGRILPSTGNLWLMGAYD-PHRRTNLNFWCNVEGIDMGCVRKPFSQEPLVEFVPIQQL 212
            |||||...|.|.|....|::....| .::...:::|.||.|.||.|::....:||||:.|..:||
Human   181 RDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQL 245

  Fly   213 LTDECFIHSTNLAVARNQPVEFQSNFQLKVMRTGIINMLVLYFDVLFPSGKSNKSVSLTTSPHSP 277
            :|:.|.|...::...:.:.:.|.|.|.|:|.|...::.||.||::.|.  :.:|....:|||.||
Human   246 VTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFT--RCHKRTGFSTSPESP 308

  Fly   278 WTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQDGRGMNFDLHISFRGE 327
            :|||:|||.::::.|.|:..:.:.|.:.|.|..::.|.::|.:.:.|:|:
Human   309 YTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQ 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 72/131 (55%)
PRMT1NP_001527.3 AdoMet_MTases 92..192 CDD:100107 60/101 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D432852at33208
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.