DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and PRMT2

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001526.2 Gene:PRMT2 / 3275 HGNCID:5186 Length:433 Species:Homo sapiens


Alignment Length:305 Identity:102/305 - (33%)
Similarity:159/305 - (52%) Gaps:14/305 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAE-AGAS 78
            :|.:||.||..|:.|:.||.|..|...:...|:|:.....||::|||||||||:|||.|. |...
Human    98 QDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPR 162

  Fly    79 KVIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMIN 143
            .|.|||.:::|....:::..|...:::.|.:..||.|.||   ||||::||||||..|..|.||.
Human   163 AVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLP---EKVDVLVSEWMGTCLLFEFMIE 224

  Fly   144 SVLFARDKWLTRGGRILPSTGNLWLMG-AYDPHRRTNLNFWCNVEGIDMG-----CVRKPFSQEP 202
            |:|:|||.||...|.|.|:...|.|:. :.|...|:.:.||.|....::.     .|::.||:..
Human   225 SILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPK 289

  Fly   203 LVEFVPIQQLLTDECFIHSTNLAVARNQPVE-FQSNFQLKVMRTGIINMLVLYFDVLFPSGKSNK 266
            ....:..:..|::.|.|...::...:...:| .:...:..:.:.|.::....:|.|.|.|.:..:
Human   290 YNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQ 354

  Fly   267 SVS-LTTSPHSPWTHWEQTVLHLDEPLYVRIRDRVRG--VLAMTP 308
            ... |:|.|..|.|||:||:..:|:|:.|...|.|.|  ||...|
Human   355 PPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNP 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 58/132 (44%)
PRMT2NP_001526.2 Interaction with ESR1 1..277 72/181 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SH3_PRMT2 34..86 CDD:212740
Interaction with RB1. /evidence=ECO:0000250 83..207 44/111 (40%)
AdoMet_MTases 110..>169 CDD:302624 26/58 (45%)
Interaction with ESR1 133..275 59/144 (41%)
AdoMet_MTases 141..241 CDD:100107 48/102 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.