DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and prmt1

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_956944.2 Gene:prmt1 / 321974 ZFINID:ZDB-GENE-030131-693 Length:348 Species:Danio rerio


Alignment Length:320 Identity:129/320 - (40%)
Similarity:204/320 - (63%) Gaps:5/320 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASKVIAV 83
            ||.||:....|..||:|.||...:|:::..:..||:||:|||||.|||||.:|||:|||.|||.:
Zfish    30 YFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNKHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGI 94

  Fly    84 ECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMINSVLFA 148
            ||:.|:|.|.:|::.|:.:::|.::||.||:||||  :|.||||:|||||..|:.|:|:|:|::|
Zfish    95 ECSSISDYAVKIVKANKLDHIVTIIKGKVEEVELP--VENVDIIISEWMGYCLFYESMLNTVIYA 157

  Fly   149 RDKWLTRGGRILPSTGNLWLMGAYD-PHRRTNLNFWCNVEGIDMGCVRKPFSQEPLVEFVPIQQL 212
            |||||...|.|.|....|::....| .::...:::|.||.|.||.|:::....||||:.|..:||
Zfish   158 RDKWLKPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKEVAITEPLVDVVDPKQL 222

  Fly   213 LTDECFIHSTNLAVARNQPVEFQSNFQLKVMRTGIINMLVLYFDVLFPSGKSNKSVSLTTSPHSP 277
            ::..|.|...::...:.:.:.|.|.|.|:|.|...|:.||.||::.|.  :.:|....:|||.||
Zfish   223 VSTACLIKEVDIYTVKIEDLSFTSPFCLQVKRNDYIHALVTYFNIEFT--RCHKRTGFSTSPESP 285

  Fly   278 WTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQDGRGMNFDLHISFRGERTRVESFKSF 337
            :|||:|||.:||:.|.|:..:.:.|.::|.|..::.|.::|.:.|.|:|:...|.....:
Zfish   286 YTHWKQTVFYLDDYLTVKTGEEIFGTISMKPNVKNNRDLDFTVDIDFKGQLCEVSKTSEY 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 69/131 (53%)
prmt1NP_956944.2 Methyltransf_18 65..169 CDD:289607 59/105 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D432852at33208
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.