DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and Etfbkmt

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001239023.1 Gene:Etfbkmt / 320204 MGIID:2443575 Length:255 Species:Mus musculus


Alignment Length:122 Identity:38/122 - (31%)
Similarity:63/122 - (51%) Gaps:8/122 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASKVIAVECTDIADIAEEIIRDNQKENV 104
            ||....::.:..:.:.|.|||:|.|.|..::.|..:||||::|   .||..||...|..|.|.|.
Mouse    94 QALSRYLLDNPAVVRGKSVLDLGSGCGATAIAAKMSGASKILA---NDIDPIAGMAITLNCKLNG 155

  Fly   105 VKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMINSV-LFARDKWLTRGGRIL 160
            :.....|.:.: |.....|.|:||   :|:..|.|.:.:|: |:.::.:.|.|.|:|
Mouse   156 LNPFPVLTKNI-LNTQQGKFDLIV---LGDMFYDEDLADSLHLWLQNYFWTHGTRVL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 38/122 (31%)
EtfbkmtNP_001239023.1 AdoMet_MTases 58..253 CDD:418430 38/122 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.