DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and CG32152

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001287079.2 Gene:CG32152 / 317885 FlyBaseID:FBgn0052152 Length:527 Species:Drosophila melanogaster


Alignment Length:313 Identity:100/313 - (31%)
Similarity:156/313 - (49%) Gaps:21/313 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASKVIAVECTDI 88
            :||:...|..:|...|..|:..|.....|.:|:.:|.:.||||.|:|.||:.||.:|.||:.:.:
  Fly   182 ARLDVMRNRQKDQAHMYFFQSVIHHQRHLIKDRTILVLCCGTGTLALMAAQMGAKRVYAVDYSKV 246

  Fly    89 ADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMINSVLFARDKWL 153
            ......::|.|..|.|:.|:.|.::.::||   .|||.|:..|||..|..|:.|..||.|||:||
  Fly   247 TGYTTLVVRQNGYEGVITVMNGRMKDLKLP---TKVDGIICNWMGYCLLYESEILEVLEARDRWL 308

  Fly   154 TRGGRILPSTGNLWLMGAYDPH--RRTNLNFWCNVEGIDMGCVRKPFSQEPLVEFVPIQQLLTDE 216
            .:||.|||....|:|: |.:.|  :....|.|.||.|.:|..:|:....||.|.....::|||..
  Fly   309 KKGGFILPDLAALYLV-ASEEHKLKSERCNHWRNVYGFNMNAIRRYALAEPCVALTTGKKLLTMA 372

  Fly   217 CFIHSTNLAVARNQPVEFQSNFQLKVMRTGIINMLVLYFDVLFPSGKSNKSVSLTTSPHSPW-TH 280
            ..:...:|..||.:.:....|.:|.|.|.|.:...:|:|:|.| |...|..:|......||: :.
  Fly   373 HCVLRLDLKRARREDLFIDRNIRLSVNREGYLECFLLFFEVQF-SNSLNFKLSCNPCLKSPFKSL 436

  Fly   281 WEQTVLHLDEPLYVRIRDRVRGVL---AMTPTG----------QDGRGMNFDL 320
            |.|:||.:::|..:|......|.|   .:.|..          .:||..::||
  Fly   437 WMQSVLFVEQPFVMRKNIHYTGNLKFKTLKPNKFNEMEICIEFYEGREYDYDL 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 49/131 (37%)
CG32152NP_001287079.2 AdoMet_MTases 215..315 CDD:100107 41/102 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450649
Domainoid 1 1.000 84 1.000 Domainoid score I1911
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.