DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and Ndufaf5

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001119843.1 Gene:Ndufaf5 / 296190 RGDID:1309829 Length:343 Species:Rattus norvegicus


Alignment Length:82 Identity:21/82 - (25%)
Similarity:36/82 - (43%) Gaps:11/82 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 IVLDVGCGTGILSLFAAEAGASKVIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGI 121
            :.||:|||.|.::....:....|:..      .||||..:: |..|..:..|..|.::..||...
  Rat    92 LALDIGCGRGYIAQHLNKETVGKIFQ------TDIAEHALK-NSIETDIPTVNILADEEFLPFPE 149

  Fly   122 EKVDIIVS----EWMGN 134
            ...|::||    .|:.:
  Rat   150 NTFDLVVSSLSLHWVND 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 21/82 (26%)
Ndufaf5NP_001119843.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..40
BioC 74..310 CDD:273953 21/82 (26%)
Methyltransf_11 94..185 CDD:285453 21/80 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.