DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and Prmt6

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001380787.1 Gene:Prmt6 / 295384 RGDID:1304701 Length:375 Species:Rattus norvegicus


Alignment Length:347 Identity:122/347 - (35%)
Similarity:182/347 - (52%) Gaps:45/347 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASK 79
            :|..|::.||.:..|..|:.|.||..|:|..|:::....:.|.|||||.||||||:|.|:|||.:
  Rat    43 RDQLYYECYSDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARR 107

  Fly    80 VIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMINS 144
            |.|||.:.|...|:|::|.|..|:.|.::.|.||.||||   |:||.|||||||..|..|:|::|
  Rat   108 VYAVEASAIWQQAQEVVRLNGLEDRVHILPGPVETVELP---EQVDAIVSEWMGYGLLHESMLSS 169

  Fly   145 VLFARDKWLTRGGRILPSTGNLWLMGAYDPHRRTNLNFWCNVE---GIDMGCVRKPFSQEPLV-- 204
            ||.||.|||..||.:||.:..|::....|......|.||..|:   |:||.|: :.|:...|:  
  Rat   170 VLHARTKWLKEGGLLLPDSAELFVAPISDQMLEWRLGFWSQVKQHYGVDMSCM-ESFATRCLMGH 233

  Fly   205 -EFVPIQQLLTDECFIHSTNLAVARNQPVEFQSNFQLKVMRTGI--------------------- 247
             |.| :|.|..::        .:||  |..|.   ||::.|.|:                     
  Rat   234 SEIV-VQGLSGED--------VLAR--PQRFA---QLELARAGLEQELEAGVGGRFRCSCYGSAP 284

  Fly   248 INMLVLYFDVLFPSGKSNKSVSLTTSPHSPWTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQD 312
            ::...::|.|.||.|.|.|.:.|:|||..|.|||:|.:|:|:||:.|.....:.|.:.:.|:..:
  Rat   285 LHGFAIWFQVTFPGGDSEKPLVLSTSPFHPATHWKQALLYLNEPVPVEQDTDISGEITLLPSRDN 349

  Fly   313 GRGMNFDLHISFRGERTRVESF 334
            .|.:...|.........:.:.|
  Rat   350 PRRLRVLLRYKVGDHEEKTKDF 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 66/131 (50%)
Prmt6NP_001380787.1 AdoMet_MTases 85..185 CDD:100107 57/102 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.