DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and Prmt9

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001178528.1 Gene:Prmt9 / 291947 RGDID:1306157 Length:841 Species:Rattus norvegicus


Alignment Length:373 Identity:92/373 - (24%)
Similarity:175/373 - (46%) Gaps:60/373 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FLEGKDSDYFQSYSRLET-HMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAE 74
            |.:.|::.|..:...:|. |..||.|:.|.:.: :|.:|.......|.|||:|.||||||:||.:
  Rat   134 FNDAKENFYRVANWLVERWHFIMLNDTKRNEIY-NAAIQKAVRLGSKTVLDIGAGTGILSMFAKK 197

  Fly    75 AGASKVIAVECT-DIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGI-EKVDIIVSEWMGNALY 137
            |||..|.|.|.: .:.::|.:::..|:.|:.::::......:|:|..| |:|.::|:|.:...::
  Rat   198 AGAHSVYACELSKTMYELACDVVAANKMEDGIRLLHMKSLDLEIPKHIPERVSLVVTETVDAGVF 262

  Fly   138 MEAMINSVLFARDKWL----TRG--------GRILPSTGNLWLM-------------GAYD---P 174
            .|.::.|::.|.:..|    |:|        |:::|::..:..|             .|.|   .
  Rat   263 GEGIVESLIHAWEHLLLQPQTKGESGSWGKYGKVIPASAVISGMAVECAEIRRHHRVSAKDIAGI 327

  Fly   175 HRRTNLNFWCNV-EGIDMGCVRKPFSQEPLVEFVPIQQLLTDECF----IHSTNLAVARNQPVEF 234
            |..||:.|.... ..:|.....:|::.|.:.......:.|| |||    :...||...::.....
  Rat   328 HLPTNVRFQSPAYASVDPEETVEPYTTEKMSGIPGGYRPLT-ECFQIMKVDFNNLQELKSLATRK 391

  Fly   235 QSNFQLKVMRTGIINMLVLYFDVLFPSGKSNKSVSLTTSPHSPWTHWEQTVLHLD--EPLYVRIR 297
            ..:..:..::.|.::.::::| ||    :.:...||:||| |..|.|||.|..:.  |..:::..
  Rat   392 PHSLSVPAVKEGTLDAIMVWF-VL----QLDDEHSLSTSP-SEETCWEQAVYPVQALEDYWIQPG 450

  Fly   298 DRVRGVLAMTPTGQDG----RGMNFDLHISFRGERTRVESFKSFSSPR 341
            |:|    .|..:..|.    :|::. ||:..     .:|..|||:..:
  Rat   451 DQV----TMEASCHDCYLRIQGISI-LHLEH-----EMEVIKSFTKSK 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 43/145 (30%)
Prmt9NP_001178528.1 TPR_11 68..132 CDD:290150
TPR repeat 68..95 CDD:276809
TPR repeat 100..130 CDD:276809
AdoMet_MTases 148..>338 CDD:302624 52/190 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.