DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and rmt1

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_594825.2 Gene:rmt1 / 2543492 PomBaseID:SPAC890.07c Length:340 Species:Schizosaccharomyces pombe


Alignment Length:314 Identity:116/314 - (36%)
Similarity:185/314 - (58%) Gaps:6/314 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LEGKDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAG 76
            |..||. ||.|||....|..||:|.||..::||||:|:..||:|||||||||||||||:|.|.||
pombe    13 LTAKDY-YFDSYSHWGIHEEMLKDDVRTLSYRDAIMQNPHLFRDKIVLDVGCGTGILSMFCARAG 76

  Fly    77 ASKVIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAM 141
            |..|..|:.::|...|.:|:..|:..:.:.:::|.:|:::||  :||||||||||||..|..|:|
pombe    77 AKHVYGVDMSEIIHKAVQIVEVNKLSDRITLIQGKMEEIQLP--VEKVDIIVSEWMGYFLLYESM 139

  Fly   142 INSVLFARDKWLTRGGRILPSTGNLWLMGAYD-PHRRTNLNFWCNVEGIDMGCVRKPFSQEPLVE 205
            :::||.|||::|...|.:.|....:.|....| .::...:.||.:|.|.|...::|...:||||:
pombe   140 LDTVLVARDRYLAPDGLLFPDRAQIQLAAIEDADYKSEKIGFWDDVYGFDFSPIKKDVWKEPLVD 204

  Fly   206 FVPIQQLLTDECFIHSTNLAVARNQPVEFQSNFQLKVMRTGIINMLVLYFDVLFPSGKSNKSVSL 270
            .|....:.|:.|.|...:|...:.:.:.|.|.|::...|...::..:.:||:.|.:  .:|.:..
pombe   205 TVDRIAVNTNSCVILDLDLKTVKKEDLAFSSPFEITATRNDFVHAFLAWFDIEFSA--CHKPIKF 267

  Fly   271 TTSPHSPWTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQDGRGMNFDLHISF 324
            :|.|.|.:|||:|||.:..:.|.|:..:.:||.:...|...:.|.::.|:..:|
pombe   268 STGPFSRYTHWKQTVFYTHKDLTVKAGEYIRGTITCKPAEGNHRELDIDISYTF 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 65/131 (50%)
rmt1NP_594825.2 AdoMet_MTases 58..158 CDD:100107 49/101 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54098
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.