DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and SPAC26A3.06

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_594149.1 Gene:SPAC26A3.06 / 2542685 PomBaseID:SPAC26A3.06 Length:268 Species:Schizosaccharomyces pombe


Alignment Length:167 Identity:35/167 - (20%)
Similarity:61/167 - (36%) Gaps:64/167 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASKVIAVECTDIAD 90
            ::|.|     |.|.....||   :|..|    :||:|||:||    :.:.|.|:...|...||:.
pombe    31 IQTEM-----SERALELLDA---EGPSF----ILDIGCGSGI----STQIGESQGHVVVGMDISP 79

  Fly    91 IAEEIIRDNQKENVVKVVKGLVEQVELPDGIE--------KVDIIVSEWMGNA------------ 135
            ....:..::|:      ::|.:...::..|:.        .:.|...:|:.||            
pombe    80 SMLSVALESQE------IEGDLLLCDMGTGVPFRPGTFDGVISISAIQWLLNADKTCNVPQRRLN 138

  Fly   136 -----LYMEAMINSVLFARDKWLTRGGRIL----PST 163
                 ||:.             :.||||.:    |.|
pombe   139 RFFQTLYIS-------------MKRGGRAVMQYYPET 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 32/160 (20%)
SPAC26A3.06NP_594149.1 AdoMet_MTases 51..159 CDD:100107 25/130 (19%)
WBS_methylT <221..266 CDD:289366
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.