DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and erg6

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_595787.1 Gene:erg6 / 2539602 PomBaseID:SPBC16E9.05 Length:378 Species:Schizosaccharomyces pombe


Alignment Length:274 Identity:62/274 - (22%)
Similarity:99/274 - (36%) Gaps:74/274 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASK 79
            |...:.||.:|.|.::     :.||           |:.....|||||||.|..:....|.....
pombe   101 KGEAFAQSIARHEHYL-----AYRM-----------GIKPGSRVLDVGCGVGGPAREITEFTGCN 149

  Fly    80 VIAVECTDIADIAEEIIRDNQ---KENVVK---VVKGLVEQVELPDGIEKVDIIVS-EWMGNALY 137
            ::.:...|.     :|.|.|.   |.|:.|   .|||  :.:.:|......|.:.: |...:|..
pombe   150 LVGLNNNDY-----QISRCNNYAVKRNLDKKQVFVKG--DFMHMPFEDNTFDYVYAIEATVHAPS 207

  Fly   138 MEAMINSVLFARDKWLTRGGRILPSTGNL----WLMG-AYD----PHRRTNLNFWCNVEGIDMG- 192
            :|.:...:.           |:|...|..    |:|. .||    .||....|       |::| 
pombe   208 LEGVYGEIF-----------RVLKPGGVFGVYEWVMSDDYDSSIPKHREIAYN-------IEVGD 254

  Fly   193 ----CVRKPFSQEPL--VEFVPIQQLLTDECFIHSTNLAVARNQPV-----EFQSNFQL-KVMRT 245
                .|||..:.|.:  |.|    .||.::......|..:....|:     :.|:.:.: .|.||
pombe   255 GIPQMVRKCDAVEAIKKVGF----NLLEEDDLTDHDNPDLPWYYPLTGDITKCQNIWDVFTVFRT 315

  Fly   246 GIINMLVLYFDVLF 259
            ..:..||..:.|.|
pombe   316 SRLGKLVTRYSVQF 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 28/138 (20%)
erg6NP_595787.1 Methyltransf_11 129..225 CDD:285453 26/113 (23%)
Sterol_MT_C 310..374 CDD:285671 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.