DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and C35D10.12

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_498018.1 Gene:C35D10.12 / 183240 WormBaseID:WBGene00016448 Length:365 Species:Caenorhabditis elegans


Alignment Length:284 Identity:67/284 - (23%)
Similarity:106/284 - (37%) Gaps:76/284 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EGKDSDYFQS-YSRLETHM------NMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSL 70
            |..:.:|..| ||||.|:.      :..|...|::.|.|.  |..|    .|:||||||....: 
 Worm     6 ENVEQEYVHSIYSRLATYQQKEHKPSSPRIWPRVRQFVDQ--QSAG----SIILDVGCGEAKYT- 63

  Fly    71 FAAEAGASKVIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNA 135
                :..|.||..      |...|::..::|:::...   |.:.:.:|...:.||.|::..:.:.
 Worm    64 ----SQKSHVIGF------DTCSEVLSSSKKDDIDLC---LADAINIPIRDDSVDAILNVSVIHH 115

  Fly   136 LYMEAMINSVLFARDKWLTRGGRILPSTGNLWLMGAYDPHRRTNLNFWCNVEGIDMGCVRKPFSQ 200
            |...|....||....:.|..||::|     ::......|:                   .|..||
 Worm   116 LATTARRRQVLQECSRCLRIGGQML-----IYAWAFEQPN-------------------GKFASQ 156

  Fly   201 EPLVEFVPIQQLLTDECFIHSTNLAVARNQPVEFQSNFQLKVMRTGIINMLVLYFDVLFP----S 261
            :.||.:           .:|.|.:. .|...|:|..| ..|..|....::.|...|...|    |
 Worm   157 DILVPW-----------NMHETAIG-GRLPKVKFHLN-TTKEQRVIAASIPVNISDGSIPQKWFS 208

  Fly   262 GKSNKSVSLTTS--------PHSP 277
            |..:|.||||..        |:||
 Worm   209 GVLSKVVSLTDQLPYFSKRCPNSP 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 31/137 (23%)
C35D10.12NP_498018.1 Methyltransf_11 53..141 CDD:369777 25/106 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.