powered by:
Protein Alignment Art6 and C27F2.4
DIOPT Version :9
Sequence 1: | NP_650322.1 |
Gene: | Art6 / 41699 |
FlyBaseID: | FBgn0038189 |
Length: | 341 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_498051.1 |
Gene: | C27F2.4 / 175671 |
WormBaseID: | WBGene00016166 |
Length: | 283 |
Species: | Caenorhabditis elegans |
Alignment Length: | 73 |
Identity: | 18/73 - (24%) |
Similarity: | 35/73 - (47%) |
Gaps: | 7/73 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 THMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASKVIAVECTDIADIA 92
:|:..::..:..:|.....:.:| :...:||:|||||:.|....:||...| ..|::...
Worm 30 SHITAIQHEMAERALELLALPEG---KSGFLLDIGCGTGMSSEVILDAGHMFV----GVDVSRPM 87
Fly 93 EEIIRDNQ 100
.||.|.::
Worm 88 LEIARQDE 95
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0500 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.