DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and C27F2.4

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_498051.1 Gene:C27F2.4 / 175671 WormBaseID:WBGene00016166 Length:283 Species:Caenorhabditis elegans


Alignment Length:73 Identity:18/73 - (24%)
Similarity:35/73 - (47%) Gaps:7/73 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 THMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASKVIAVECTDIADIA 92
            :|:..::..:..:|.....:.:|   :...:||:|||||:.|....:||...|    ..|::...
 Worm    30 SHITAIQHEMAERALELLALPEG---KSGFLLDIGCGTGMSSEVILDAGHMFV----GVDVSRPM 87

  Fly    93 EEIIRDNQ 100
            .||.|.::
 Worm    88 LEIARQDE 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 18/72 (25%)
C27F2.4NP_498051.1 SmtA 23..253 CDD:223574 18/73 (25%)
Methyltransf_11 58..163 CDD:285453 15/42 (36%)
WBS_methylT 206..281 CDD:289366
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.