DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and Prmt2

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001289894.1 Gene:Prmt2 / 15468 MGIID:1316652 Length:475 Species:Mus musculus


Alignment Length:349 Identity:107/349 - (30%)
Similarity:165/349 - (47%) Gaps:50/349 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASK 79
            :|.:||.||..|:.|:.||.|..|...:...|:|:....:||::|||||||||:|||.|.....|
Mouse   110 QDEEYFDSYGTLKLHLEMLADQPRTTKYHSVILQNKESLKDKVILDVGCGTGIISLFCAHHARPK 174

  Fly    80 -VIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMIN 143
             |.|||.:|:|....:::..|...:.:.|.:..||.|.||   ||||::||||||..|..|.||.
Mouse   175 AVYAVEASDMAQHTSQLVLQNGFADTITVFQQKVEDVVLP---EKVDVLVSEWMGTCLLFEFMIE 236

  Fly   144 SVLFARDKWLTRGGRILPSTGNLWLM---GAYDPHRRTNLNFWCNVEGIDMG-----CVRKPFSQ 200
            |:|:|||.||...|.|.|:|..|.|:   ...|.|  :.:.||.|....::.     .:::.||:
Mouse   237 SILYARDTWLKGDGIIWPTTAALHLVPCSAEKDYH--SKVLFWDNAYEFNLSALKSLAIKEFFSR 299

  Fly   201 EPLVEFVPIQQLLTDECFIHSTNLAVARNQPVE-FQSNFQLKVMRTGIINMLVLYFDVLFPSGKS 264
            ......:..:..|::.|.|...::...:...:| .:...:..:.:.|.::....:|.|.|.|.:.
Mouse   300 PKSNHILKPEDCLSEPCTILQLDMRTVQVPDLETMRGELRFDIQKAGTLHGFTAWFSVYFQSLEE 364

  Fly   265 NKSVS-LTTSPHSP-------------W-----------------THWEQTVLHLDEPLYVRIRD 298
            .:... |:|.|..|             |                 |||:||:..:|:|:.|...|
Mouse   365 GQPQQVLSTGPLHPFLGRTGCQCRGPRWSCQMRPVGDRMLLSCSTTHWKQTLFMMDDPVPVHTGD 429

  Fly   299 RVRG--VLAMTPTGQDGRGMNFDL 320
            .|.|  ||...|..:  |.|:..|
Mouse   430 VVTGSVVLQRNPVWR--RHMSVSL 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 59/132 (45%)
Prmt2NP_001289894.1 SH3_PRMT2 46..98 CDD:212740
AdoMet_MTases 122..>181 CDD:302624 26/58 (45%)
AdoMet_MTases 153..253 CDD:100107 49/102 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.