DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and ATPSCKMT

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_954584.2 Gene:ATPSCKMT / 134145 HGNCID:27029 Length:233 Species:Homo sapiens


Alignment Length:72 Identity:17/72 - (23%)
Similarity:29/72 - (40%) Gaps:25/72 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LPFLEGKDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAA 73
            |||:..       :..::|..:.|||            .:.|.|      :|:|.|.|.:.:.||
Human    68 LPFVPA-------TTKQIENVVKMLR------------CRRGSL------VDIGSGDGRIVIAAA 107

  Fly    74 EAGASKV 80
            :.|.:.|
Human   108 KKGFTAV 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 13/52 (25%)
ATPSCKMTNP_954584.2 Required for mitochondrial location. /evidence=ECO:0000269|PubMed:30530489 56..90 7/40 (18%)
AdoMet_MTases 83..>188 CDD:388410 13/50 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.