DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and CARM1_ANOGA

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_318375.4 Gene:CARM1_ANOGA / 1278750 VectorBaseID:AGAP003923 Length:622 Species:Anopheles gambiae


Alignment Length:328 Identity:108/328 - (32%)
Similarity:177/328 - (53%) Gaps:22/328 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASKVI 81
            |.|||.|..|....||::|.||...::.||..:...||:|||||||.|:||||.||.:|||:||.
Mosquito   119 SQYFQFYGYLSQQQNMMQDFVRTSTYQRAIYNNAQDFQNKIVLDVGAGSGILSFFAVQAGAAKVY 183

  Fly    82 AVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMINSVL 146
            |||.:::|..|::::..|...:.:.|:.|.:|:::||   |:||:|:||.||..||.|.|:.:.|
Mosquito   184 AVEASNMAQYAQQLVSSNNLTDRIIVIAGKIEEIDLP---ERVDVIISEPMGYMLYNERMLETYL 245

  Fly   147 FARDKWLTRGGRILPSTGNLWLMGAYDP----HRRTNLNFWCNVE--GIDMGCVR----KPFSQE 201
            ..: |||...|::.||.|:|.:....|.    .:....|||...|  |:::..:|    |.:.::
Mosquito   246 HGK-KWLKPDGKMYPSRGDLHVAPFTDEALYMEQYNKANFWMQTEFHGVNLVALRDAAMKEYFRQ 309

  Fly   202 PLVEFVPIQQLLTDECFIHSTNLAVARNQPV-EFQSNFQLKVMRTGIINMLVLYFDVLFPSGKSN 265
            |:|:...| ::...:...|:||...|..:.: ..|.:.:..::.||..:.|..:|||.|....| 
Mosquito   310 PIVDTFDI-RICMAKSIRHTTNFLTADEKDLHRIQIDVEFHMLETGTCHGLAFWFDVEFAGTCS- 372

  Fly   266 KSVSLTTSPHSPWTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQDGRGMNFDLHISFRGERTR 330
             .:.|:|||..|.|||.|....|..|::|:....:.|.:.:..    .:..::|:.|..:.|.|.
Mosquito   373 -QIWLSTSPTEPLTHWYQVRCLLQTPIFVKQGQVLSGKVVLAA----NQRQSYDVEIDLKLEGTM 432

  Fly   331 VES 333
            :.|
Mosquito   433 ISS 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 56/131 (43%)
CARM1_ANOGAXP_318375.4 PRMT5 <136..407 CDD:282971 94/277 (34%)
AdoMet_MTases 160..261 CDD:100107 46/104 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.