DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Art6 and AgaP_AGAP003728

DIOPT Version :9

Sequence 1:	NP_650322.1	Gene:	Art6 / 41699	FlyBaseID:	FBgn0038189	Length:	341	Species:	Drosophila melanogaster
Sequence 2:	XP_310259.2	Gene:	AgaP_AGAP003728 / 1271461	VectorBaseID:	AGAP003728	Length:	278	Species:	Anopheles gambiae

Alignment Length:	81	Identity:	20/81 - (24%)
Similarity:	40/81 - (49%)	Gaps:	5/81 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly    56 KIVLDVGCGTGILSLFAAEAGASKVIAVECTDIADIAEEIIRDNQKENVV-KVVKGLVEQVELPD 119
            :::||:|||:|:......|.|...:.......:.|:|.|  |:.:.:.:: .:.:|:..:....|
Mosquito    54 QLILDIGCGSGLSGSVLEEQGHVWIGVDISQSMLDVAVE--REVEGDLLLGDMGQGMPFKAGTFD 116

  Fly   120 GIEKVDIIVSEWMGNA 135
            |  .|.|...:|:.||
Mosquito   117 G--AVSISALQWLCNA 130

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Art6	NP_650322.1	AdoMet_MTases	29..>161	CDD:302624	20/81 (25%)
AgaP_AGAP003728	XP_310259.2	Methyltransf_11	57..132	CDD:285453	20/78 (26%)
AgaP_AGAP003728	XP_310259.2	WBS_methylT	203..274	CDD:289366
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0500
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900