DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and BUD23

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_006715910.1 Gene:BUD23 / 114049 HGNCID:16405 Length:304 Species:Homo sapiens


Alignment Length:207 Identity:34/207 - (16%)
Similarity:70/207 - (33%) Gaps:89/207 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VLDVGCGTGILSLFAAEAG-------ASKVIAVECTD--------IADIAEEI------------ 95
            :||:|||||:...:.::.|       .|..:..|..|        :.|:.:.|            
Human    80 LLDIGCGTGLSGSYLSDEGHYWVGLDISPAMLDEAVDREIEGDLLLGDMGQGIPFKPGTFDGCIS 144

  Fly    96 -------IRDNQK-ENVVK------------VVKGLVEQVEL-PDGIEKVDIIVSE--------- 130
                   ...|:| ||..|            :|:|....::| |:..|::::|.::         
Human   145 ISAVQWLCNANKKSENPAKRLYCFFASLFSVLVRGSRAVLQLYPENSEQLELITTQATKAGFSGG 209

  Fly   131 ------------------WMGNALYM---------EAMINSVLFARDKW---LTRGGRILPSTGN 165
                              :.|.:.::         |......:|..:::   ::|.|.:..|  .
Human   210 MVVDYPNSAKAKKFYLCLFSGPSTFIPEGLSENQDEVEPRESVFTNERFPLRMSRRGMVRKS--R 272

  Fly   166 LWLMGAYDPHRR 177
            .|::...:.|||
Human   273 AWVLEKKERHRR 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 29/189 (15%)
BUD23XP_006715910.1 AdoMet_MTases 38..>117 CDD:302624 10/36 (28%)
Methyltransf_11 81..184 CDD:285453 20/102 (20%)
WBS_methylT 227..302 CDD:289366 10/60 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.