DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and CARM1

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_954592.1 Gene:CARM1 / 10498 HGNCID:23393 Length:608 Species:Homo sapiens


Alignment Length:332 Identity:110/332 - (33%)
Similarity:180/332 - (54%) Gaps:22/332 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EGKDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGA 77
            |.....|||.|..|....||::|.||...::.||:|:...|:||||||||||:||||.|||:|||
Human   143 ESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQAGA 207

  Fly    78 SKVIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMI 142
            .|:.|||.:.:|..||.:::.|...:.:.|:.|.||:|.||   |:||||:||.||..|:.|.|:
Human   208 RKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLP---EQVDIIISEPMGYMLFNERML 269

  Fly   143 NSVLFARDKWLTRGGRILPSTGNLWLMGAYDP----HRRTNLNFWC--NVEGIDMGCVR----KP 197
            .|.|.|: |:|...|.:.|:.|::.|....|.    .:.|..|||.  :..|:|:..:|    ..
Human   270 ESYLHAK-KYLKPSGNMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDE 333

  Fly   198 FSQEPLVEFVPIQQLLTDECFIHSTNLAVARNQPV-EFQSNFQLKVMRTGIINMLVLYFDVLFPS 261
            :.::|:|:...| ::|..:...::.|...|:...: ..:..|:..::.:|:::.|..:|||.|..
Human   334 YFRQPVVDTFDI-RILMAKSVKYTVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIG 397

  Fly   262 GKSNKSVSLTTSPHSPWTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQDGRGMNFDLHISFRG 326
              |..:|.|:|:|..|.|||.|.......||:.:..|.:.|...:..    .:..::|:.|..:.
Human   398 --SIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIA----NKRQSYDISIVAQV 456

  Fly   327 ERTRVES 333
            ::|..:|
Human   457 DQTGSKS 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 62/131 (47%)
CARM1NP_954592.1 CARM1 34..138 CDD:288395
PRMT5 <172..435 CDD:282971 94/269 (35%)
Methyltransf_18 184..283 CDD:289607 52/102 (51%)
Transactivation domain. /evidence=ECO:0000250 499..608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.