DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and PRMT3

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_005779.1 Gene:PRMT3 / 10196 HGNCID:30163 Length:531 Species:Homo sapiens


Alignment Length:317 Identity:121/317 - (38%)
Similarity:197/317 - (62%) Gaps:14/317 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EGKDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGA 77
            |.:|..||.||.....|..||:|.:|.:::||.|.|:..:|:||:||||||||||||:|||:|||
Human   214 EDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGA 278

  Fly    78 SKVIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMI 142
            .||:.|:.::|...|.:|||.|:.|:.:.::||.:|:|.||  :||||:|:|||||..|..|:|:
Human   279 KKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLP--VEKVDVIISEWMGYFLLFESML 341

  Fly   143 NSVLFARDKWLTRGGRILPSTGNLWLMGAYDPHRRTN-LNFWCNVEGIDMGCVRKPFSQEPLVEF 206
            :|||:|::|:|.:||.:.|....:.|:...|.::..: :.||.:|.|..|.|::|....|.:||.
Human   342 DSVLYAKNKYLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEV 406

  Fly   207 VPIQQLLTDECFI-----HSTNLAVARNQPVEFQSNFQLKVMRTGIINMLVLYFDVLFPSGKSNK 266
            :..:.|:::.|.|     |:|:::     .:||.|:|.||:.||.:...:..|||:.|.....|:
Human   407 LDPKTLISEPCGIKHIDCHTTSIS-----DLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNR 466

  Fly   267 SVSLTTSPHSPWTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQDGRGMNFDLHIS 323
             |..:|.|.|..|||:|||..|::|..|:..:.::|.:.:....:|.|.:...|.::
Human   467 -VVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKDPRSLTVTLTLN 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 67/131 (51%)
PRMT3NP_005779.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
AdoMet_MTases 259..359 CDD:100107 55/101 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148158
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D432852at33208
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.