DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and prmt8

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_002938739.2 Gene:prmt8 / 100491340 XenbaseID:XB-GENE-6037618 Length:396 Species:Xenopus tropicalis


Alignment Length:310 Identity:123/310 - (39%)
Similarity:204/310 - (65%) Gaps:5/310 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASKVIAV 83
            ||.||:....|..||:|.||...:|:::..:..:|:||:|||||.||||||:|||:|||.||..:
 Frog    78 YFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGARKVYGI 142

  Fly    84 ECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMINSVLFA 148
            ||:.::|.:|:||:.|..:|::.:.:|.||:||||  ::|||||::||||..|:.|:|:|:|:||
 Frog   143 ECSSVSDYSEKIIKANHLDNIITIFRGKVEEVELP--VDKVDIIITEWMGYCLFYESMLNTVIFA 205

  Fly   149 RDKWLTRGGRILPSTGNLWLMGAYD-PHRRTNLNFWCNVEGIDMGCVRKPFSQEPLVEFVPIQQL 212
            |||||..||.:.|....|:::...| .::...:::|.||.|.||.|:|....:||||:.|..:|:
 Frog   206 RDKWLKPGGLMFPDRAALYIVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAIKEPLVDIVDPKQV 270

  Fly   213 LTDECFIHSTNLAVARNQPVEFQSNFQLKVMRTGIINMLVLYFDVLFPSGKSNKSVSLTTSPHSP 277
            :|:.|.|...::...:.:.:.|.:.|.|:|.|...::.||.||::.|.  |.:|....:|:|.:|
 Frog   271 VTNSCLIKEIDIYTVKTEELAFTAAFCLQVQRNDYVHALVTYFNIEFT--KCHKKTGFSTAPDAP 333

  Fly   278 WTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQDGRGMNFDLHISFRGE 327
            :|||:|||.:|::.|.||..:.:.|.::|.|...:.|.::|.:.:.|:|:
 Frog   334 YTHWKQTVFYLEDYLTVRRGEELFGTISMKPNANNIRDLDFTVDLDFKGQ 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 67/131 (51%)
prmt8XP_002938739.2 Methyltransf_25 117..214 CDD:379312 55/98 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D432852at33208
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.