DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and zc3h12c

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_002938007.2 Gene:zc3h12c / 100490495 XenbaseID:XB-GENE-6045328 Length:884 Species:Xenopus tropicalis


Alignment Length:196 Identity:41/196 - (20%)
Similarity:63/196 - (32%) Gaps:79/196 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 PHRRTNLNFWCNVEGIDMGCVRKPFS-----------------QEPLVEFVPIQQLLTDECFIHS 221
            ||.|:.|..:       |.|..:|.:                 |.|.:...|  |.||       
 Frog   667 PHTRSGLQTY-------MSCYHEPLTRVQSFGHEQEQKHHHKPQSPYMSGPP--QHLT------- 715

  Fly   222 TNLAVARNQPVEFQSNFQLKVMRTGIINMLVLYFDVLFPSGKS-----NKSVS---LTTSP---- 274
              :|...:.|.:::.:....|.|.||:             |:|     .:|:|   |..||    
 Frog   716 --VAARSSCPNDYRISQNSPVSRNGIM-------------GRSLVSTRMESISDSRLYESPPPRH 765

  Fly   275 HSPWTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQDGRGMNFDLHISFRGERTRVESFKSFSS 339
            |.|:...|.|          |..:|        |.|.|..|...:..:|....:...:.| :|.|
 Frog   766 HKPYLSQEAT----------RSWER--------PYGMDSYGYCQNYSVSSNPSQPCYDQF-AFQS 811

  Fly   340 P 340
            |
 Frog   812 P 812

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624
zc3h12cXP_002938007.2 UBA_6 165..206 CDD:375509
PIN_Zc3h12-like 251..381 CDD:350296
zf-CCCH_4 418..436 CDD:375512
Regnase_1_C 839..879 CDD:375987
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.