Sequence 1: | NP_650322.1 | Gene: | Art6 / 41699 | FlyBaseID: | FBgn0038189 | Length: | 341 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002938007.2 | Gene: | zc3h12c / 100490495 | XenbaseID: | XB-GENE-6045328 | Length: | 884 | Species: | Xenopus tropicalis |
Alignment Length: | 196 | Identity: | 41/196 - (20%) |
---|---|---|---|
Similarity: | 63/196 - (32%) | Gaps: | 79/196 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 174 PHRRTNLNFWCNVEGIDMGCVRKPFS-----------------QEPLVEFVPIQQLLTDECFIHS 221
Fly 222 TNLAVARNQPVEFQSNFQLKVMRTGIINMLVLYFDVLFPSGKS-----NKSVS---LTTSP---- 274
Fly 275 HSPWTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQDGRGMNFDLHISFRGERTRVESFKSFSS 339
Fly 340 P 340 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Art6 | NP_650322.1 | AdoMet_MTases | 29..>161 | CDD:302624 | |
zc3h12c | XP_002938007.2 | UBA_6 | 165..206 | CDD:375509 | |
PIN_Zc3h12-like | 251..381 | CDD:350296 | |||
zf-CCCH_4 | 418..436 | CDD:375512 | |||
Regnase_1_C | 839..879 | CDD:375987 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0500 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |