DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and etfbkmt

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_002941663.1 Gene:etfbkmt / 100486545 XenbaseID:XB-GENE-5900998 Length:247 Species:Xenopus tropicalis


Alignment Length:147 Identity:42/147 - (28%)
Similarity:61/147 - (41%) Gaps:36/147 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASKVIAVECTDIADIAEEIIRDNQK 101
            ||.......||:.|.      |||:|||.|..::.|...|||.|:|   .||..:|.|..:.|.:
 Frog    89 VRFLLDNPQIVRGGS------VLDLGCGCGAAAIAAGMGGASYVLA---NDIDPVAGEAFKLNCE 144

  Fly   102 ENVVKVVKGLVEQVELPDGIEKVDII---VSEW----MGNALYMEAMINSVLFARDKWLTRGGRI 159
            .|..|           |...:..::|   |:.|    :|:..|.|.:.:.:    ..||   ||.
 Frog   145 LNSTK-----------PLDFQAENLIGQEVAPWSLIVLGDMFYDEDLADLL----HDWL---GRC 191

  Fly   160 LPSTGNLWLMGAYDPHR 176
            :...|...|:|  ||.|
 Frog   192 VGRHGTKVLIG--DPGR 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 36/130 (28%)
etfbkmtXP_002941663.1 Nnt1 26..246 CDD:226413 42/147 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.