DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and carm1

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_002942887.1 Gene:carm1 / 100170180 XenbaseID:XB-GENE-484572 Length:602 Species:Xenopus tropicalis


Alignment Length:344 Identity:112/344 - (32%)
Similarity:184/344 - (53%) Gaps:26/344 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ANQKLPFLEGKDS----DYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGT 65
            |::|..|.|..:.    .|||.|..|....||::|.||...::.||:|:...|:||:|||||||:
 Frog   102 ASEKSVFSERTEESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKVVLDVGCGS 166

  Fly    66 GILSLFAAEAGASKVIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSE 130
            ||||.||.:|||.||.|||.:.:|..||.:::.|...:.:.|:.|.||:..||   |:||||:||
 Frog   167 GILSFFAVQAGARKVYAVEASTMAQHAELLVKSNNLTDRIVVIPGKVEETALP---EQVDIIISE 228

  Fly   131 WMGNALYMEAMINSVLFARDKWLTRGGRILPSTGNLWLMGAYDP----HRRTNLNFWC--NVEGI 189
            .||..|:.|.|:.|.|.|: |:|...|.:.|:.|::.|....|.    .:.|..|||.  :..|:
 Frog   229 PMGYMLFNERMLESYLHAK-KFLKPNGNMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGV 292

  Fly   190 DMGCVR----KPFSQEPLVEFVPIQQLLTDECFIHSTNLAVARNQPV-EFQSNFQLKVMRTGIIN 249
            |:..:|    ..:.::|:|:...| ::|..:...::.|...|:...: ..:..|...::.:|:::
 Frog   293 DLSALRGAAVDEYFKQPVVDTFDI-RILMAKSVKYTVNFLDAKEADLHRIEIPFSFHMLHSGLVH 356

  Fly   250 MLVLYFDVLFPSGKSNKSVSLTTSPHSPWTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQDGR 314
            .|..:|||.|..  |..:|.|:|:|..|.|||.|....|..||:.:..|.:.|...:..    .:
 Frog   357 GLAFWFDVAFIG--SIMTVWLSTAPTEPLTHWYQVRCLLQSPLFTKAGDTLTGTALLIA----NK 415

  Fly   315 GMNFDLHISFRGERTRVES 333
            ..::|:.|..:.::|..:|
 Frog   416 RQSYDISIVAQVDQTGSKS 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 60/131 (46%)
carm1XP_002942887.1 CARM1 9..109 CDD:371585 2/6 (33%)
Methyltransf_25 159..254 CDD:379312 48/98 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.