DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and prmt6

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001120104.1 Gene:prmt6 / 100145123 XenbaseID:XB-GENE-5857258 Length:340 Species:Xenopus tropicalis


Alignment Length:330 Identity:121/330 - (36%)
Similarity:190/330 - (57%) Gaps:15/330 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASK 79
            :|.:|||.||.:..|..|:.|:||..|::.|::::....|.|.|||||.||||||:|:.:|||..
 Frog    14 QDCEYFQCYSDVSVHEEMIADTVRTNAYKLALLRNHSSLQGKTVLDVGAGTGILSVFSVQAGAQA 78

  Fly    80 VIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMINS 144
            |.|||.:.::.:|.::::.|..||.|||:...||..|:|   |:||.|||||||.||..|:|:.|
 Frog    79 VYAVEASSMSQLACQVVKSNDMENKVKVLNSSVESAEIP---EQVDAIVSEWMGYALMYESMLPS 140

  Fly   145 VLFARDKWLTRGGRILPSTGNLWLMGAYDPHRRTNLNFWCNVE---GIDMGCVRK-----PFSQE 201
            |::||||||..||.||||..:|::....|....:.|:||..|:   |:||.|::.     ..::|
 Frog   141 VIYARDKWLKPGGLILPSCADLFIAPVNDLIVESRLDFWSEVKGMYGVDMSCMQSFARSCIMNKE 205

  Fly   202 PLVEFVPIQQLLTDECFIHSTNLAVARNQPV-EFQSNFQLKVMRTGIINMLVLYFDVLFPSGKSN 265
            ..|..|..:.:|:......|.:|.|...:.| ....:||.....:.:::...::|.|.||   ..
 Frog   206 MAVNLVSPEDVLSFPVRFASLDLNVCTQEEVRNLHGSFQFSCFGSSLLHGFAVWFSVTFP---GE 267

  Fly   266 KSVSLTTSPHSPWTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQDGRGMNFDLHISFRGERTR 330
            .||:|:|||:...|||:||:|:|||.:.|.....:.|.:.::|:..:.|.:...|:.|..|...|
 Frog   268 NSVTLSTSPYGEETHWKQTLLYLDEEVQVEQDTEITGDVTLSPSDINPRHLRVLLNYSIGGGLRR 332

  Fly   331 VESFK 335
            .:.|:
 Frog   333 TKQFQ 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 64/131 (49%)
prmt6NP_001120104.1 AdoMet_MTases 56..156 CDD:100107 54/102 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.