DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and schip1

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_012818101.1 Gene:schip1 / 100126222 XenbaseID:XB-GENE-1011068 Length:530 Species:Xenopus tropicalis


Alignment Length:213 Identity:40/213 - (18%)
Similarity:67/213 - (31%) Gaps:82/213 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KLPFLEGKDSDYFQSYSRLETHMNMLR---------------DSVRMQAFRDAIV----QDGGLF 53
            |:..::....:|.|....|  |.|.:.               .|:.|..|.:...    :||   
 Frog    48 KVKIIQRAWREYLQRQDPL--HSNCMEKRSPSPSSLSSDKMSSSISMNTFSEGCTPDYREDG--- 107

  Fly    54 QDKIVLDVGCGTGILSLFAAEAGASKVIAVECTD-----------IADIAEEII---------RD 98
                 :|:  |:...|..::|:.::||  ..|:|           :.|..||..         .|
 Frog   108 -----MDL--GSDACSRSSSESSSNKV--TPCSDCKSSPSLELAALEDYEEEDFLVDKVSDEWED 163

  Fly    99 NQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMINSVLFARDKWLTRGGRILPST 163
            :.:|:.|.||          ||..|.:.......|.:|           |.:....:.|.:..|.
 Frog   164 DDEEDEVGVV----------DGFPKDNCFARIGTGRSL-----------AEEFEDVKSGTVSASN 207

  Fly   164 GNLWLMGAYDPHRRTNLN 181
            ||        |..:..||
 Frog   208 GN--------PSPKHKLN 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 30/170 (18%)
schip1XP_012818101.1 IQCJ-SCHIP1 4..>101 CDD:373608 9/54 (17%)
SCHIP-1 298..521 CDD:370831
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165167572
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.