powered by:
Protein Alignment Art6 and zgc:194242
DIOPT Version :9
Sequence 1: | NP_650322.1 |
Gene: | Art6 / 41699 |
FlyBaseID: | FBgn0038189 |
Length: | 341 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001122287.1 |
Gene: | zgc:194242 / 100005854 |
ZFINID: | ZDB-GENE-081022-84 |
Length: | 210 |
Species: | Danio rerio |
Alignment Length: | 31 |
Identity: | 8/31 - (25%) |
Similarity: | 16/31 - (51%) |
Gaps: | 4/31 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 ETHMNMLRD----SVRMQAFRDAIVQDGGLF 53
|.:|:.|:. .||::..||.::....:|
Zfish 175 EVYMDALQSCGFTDVRLEDNRDKLIHFQAIF 205
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0500 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.