DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and carm1l

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_009303379.2 Gene:carm1l / 100003090 ZFINID:ZDB-GENE-090312-219 Length:450 Species:Danio rerio


Alignment Length:354 Identity:116/354 - (32%)
Similarity:184/354 - (51%) Gaps:37/354 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSFNANQKLPFLEGKDS---DYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVG 62
            |....:|.:.....:||   .|||       ..|||:|.:|...::.|::.:...|:||:|||||
Zfish   108 MHLRRDQSVFRQRSEDSSALQYFQ-------QQNMLQDFLRTATYQKAMLLNEDDFKDKVVLDVG 165

  Fly    63 CGTGILSLFAAEAGASKVIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDII 127
            |||||||.||.:|||.||.|||.:.:|..||.::|.|...|.:.|:.|.:|:|..|   ||||:|
Zfish   166 CGTGILSFFAVQAGAQKVYAVEASTVAKYAEMLVRSNGLSNKITVLSGRIEEVSCP---EKVDVI 227

  Fly   128 VSEWMGNALYMEAMINSVLFARDKWLTRGGRILPSTGNLWLMGAYDPH----RRTNLNFW---C- 184
            :||.||..|..|.|:.|.|.|: .||...|.:.|:..::.|....|.|    .....|||   | 
Zfish   228 ISEPMGYMLLNERMLESFLHAK-HWLKPKGMMFPTQSDIHLAPFTDEHLYMEHHARSNFWNQSCF 291

  Fly   185 ---NVEGIDMGCVRKPFSQEPLVEFVPIQQLLTDECFIHSTNLAVARNQPV-EFQSNFQLKVMRT 245
               |:.|:....|.: |.::|:|:...: |:|......::.|...|:.:.: ..:..|..|::::
Zfish   292 YGVNLSGLHSSAVDE-FFKQPIVDTFDM-QILMARSVKYTINFLEAKEEDLHRLEIPFVFKLLQS 354

  Fly   246 GIINMLVLYFDVLFPSGKSNKSVSLTTSPHSPWTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTG 310
            |:|:.|..:|||.|...|  .::.|:|||..|.|||.|....|..||:.::...:.|.:.:..  
Zfish   355 GLIHGLAFWFDVAFVGSK--MTIWLSTSPTEPLTHWYQVRCLLQTPLFAKMGQTLSGHVHLIA-- 415

  Fly   311 QDGRGMNFDLHISFRGERTRVESFKSFSS 339
              .:..::|:|||...:::   .|||.:|
Zfish   416 --NKRQSYDIHISAVVDQS---GFKSGNS 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 60/131 (46%)
carm1lXP_009303379.2 PH-like <32..119 CDD:327399 2/10 (20%)
PRMT5 <101..410 CDD:310055 107/316 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.