DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and RAX2

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_116142.1 Gene:RAX2 / 84839 HGNCID:18286 Length:184 Species:Homo sapiens


Alignment Length:84 Identity:33/84 - (39%)
Similarity:47/84 - (55%) Gaps:13/84 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 PFRKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQ 448
            |.:|.:|.||.|:..||.:||.|||::.|.....|:.||..::|.|.:|:|||||||.|.:|   
Human    23 PKKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREELAAKVHLPEVRVQVWFQNRRAKWRR--- 84

  Fly   449 EDEKGGEGGSQRNMHNGSG 467
                      |..:.:|||
Human    85 ----------QERLESGSG 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649 26/55 (47%)
RAX2NP_116142.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33 4/9 (44%)
Homeodomain 28..84 CDD:459649 26/55 (47%)

Return to query results.
Submit another query.