DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and HB52

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_200209.1 Gene:HB52 / 835481 AraportID:AT5G53980 Length:156 Species:Arabidopsis thaliana


Alignment Length:127 Identity:29/127 - (22%)
Similarity:46/127 - (36%) Gaps:42/127 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 KPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTK--------- 442
            |.||:    :..|:.:||..|..|:.:....:..|:..|.|.:.||.|||||:|.:         
plant    11 KKKRL----TQDQVRQLEKCFTMNKKLEPDLKLQLSNQLGLPQRQVAVWFQNKRARFKTQSLEVQ 71

  Fly   443 HKRMQQEDEKG-----------------------------GEGGSQRNMHNGSGDEDDDELI 475
            |..:|.:.|..                             .:.....|.:.||.|||.|:.:
plant    72 HCTLQSKHEAALSDKAKLEHQVQFLQDELKRARNQLALFTNQDSPVDNSNLGSCDEDHDDQV 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649 19/64 (30%)
HB52NP_200209.1 Homeodomain 11..64 CDD:459649 19/56 (34%)

Return to query results.
Submit another query.