DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and HB40

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001329011.1 Gene:HB40 / 829827 AraportID:AT4G36740 Length:217 Species:Arabidopsis thaliana


Alignment Length:117 Identity:37/117 - (31%)
Similarity:57/117 - (48%) Gaps:30/117 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 FRKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERK-ALAQNLNLSETQVKVWFQNRRT--KHKRM 446
            |||.|     .:..|:..||.:| .:::.:.:||| .||..|.|...||.|||||||.  |:||:
plant    55 FRKRK-----LTDEQVNMLEMSF-GDEHKLESERKDRLAAELGLDPRQVAVWFQNRRARWKNKRL 113

  Fly   447 QQEDEKGGEGGSQRNMHNGSGDEDDDELID--------MEMDECPSDEEHEL 490
            ::|..|      .:|.|       |:.::|        :::.|...|.|.|:
plant   114 EEEYNK------LKNSH-------DNVVVDKCRLESEVIQLKEQLYDAEREI 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649 22/58 (38%)
HB40NP_001329011.1 HOX 56..109 CDD:197696 23/58 (40%)

Return to query results.
Submit another query.