DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and HAT3

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_191598.1 Gene:HAT3 / 825210 AraportID:AT3G60390 Length:315 Species:Arabidopsis thaliana


Alignment Length:61 Identity:26/61 - (42%)
Similarity:36/61 - (59%) Gaps:2/61 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 KRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQE 449
            |::|  .|..|.|.||..|:.:..:...::.|||:.|||...||:|||||||.:.|..|.|
plant   162 KKLR--LSKEQALVLEETFKEHSTLNPKQKMALAKQLNLRTRQVEVWFQNRRARTKLKQTE 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649 23/55 (42%)
HAT3NP_191598.1 HD-ZIP_N 19..118 CDD:461370
Homeodomain 161..215 CDD:459649 23/54 (43%)
HALZ 217..260 CDD:128634 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.