DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and Msx1

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_112321.2 Gene:Msx1 / 81710 RGDID:620929 Length:303 Species:Rattus norvegicus


Alignment Length:247 Identity:73/247 - (29%)
Similarity:96/247 - (38%) Gaps:70/247 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 MPPAGLVRPFPMG----------PGGPPMPQGQPGLPDIKALPPYIN---APPELPPQHNPHLIA 312
            |.||..:...|:|          |.|....|. ||.....|.....:   |.|::|....|..: 
  Rat     1 MAPAAAMTSLPLGVKVEDSAFAKPAGGGAGQA-PGAAAATATAMGTDEEGAKPKVPASLLPFSV- 63

  Fly   313 AAQFQMAAALQAGH--------VLGPAAAAAAAAGLPPHA-----------AQFMPNP------- 351
                   .||.|.|        ||..:..|.||.|...|.           |...|.|       
  Rat    64 -------EALMADHRKPGAKESVLVASEGAQAAGGSVQHLGTRPGSLGAPDAPSSPGPLGHFSVG 121

  Fly   352 GMAR------------DSYQLYPWLLSRHGRIFPHRFPGSFLVPP---FRKPK---RIRTAFSPS 398
            |:.:            :.....||:.|  .|..|.  |...|.||   .||.|   :.||.|:.:
  Rat   122 GLLKLPEDALVKAESPEKLDRTPWMQS--PRFSPP--PARRLSPPACTLRKHKTNRKPRTPFTTA 182

  Fly   399 QLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQED 450
            |||.||..|...||:..|||...:.:|:|:|||||:||||||.|.||:|:.:
  Rat   183 QLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAE 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 28/51 (55%)
Msx1NP_112321.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.