DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and HB17

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_178252.2 Gene:HB17 / 814671 AraportID:AT2G01430 Length:275 Species:Arabidopsis thaliana


Alignment Length:69 Identity:26/69 - (37%)
Similarity:39/69 - (56%) Gaps:5/69 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 PPFRKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQ 447
            ||   .|::|.....|:|  ||.:|..|..:...:::.||::|.|...|::|||||||.:.|..|
plant   136 PP---RKKLRLTREQSRL--LEDSFRQNHTLNPKQKEVLAKHLMLRPRQIEVWFQNRRARSKLKQ 195

  Fly   448 QEDE 451
            .|.|
plant   196 TEME 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649 20/55 (36%)
HB17NP_178252.2 HOX 136..192 CDD:197696 22/60 (37%)
HALZ 194..237 CDD:128634 3/6 (50%)

Return to query results.
Submit another query.