DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and Nkx6-3

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001102925.1 Gene:Nkx6-3 / 685102 RGDID:1597780 Length:262 Species:Rattus norvegicus


Alignment Length:260 Identity:67/260 - (25%)
Similarity:97/260 - (37%) Gaps:84/260 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 MPPAGLVRPFPMGPGGPPMPQGQP-GLPDIKALPPYINAPPELPPQHNPHLIAAAQFQMAAALQA 324
            :.|.||         ||.:..|.| |:.||.:.|.   |.|.                  ::|.:
  Rat    38 LSPPGL---------GPQLAAGTPHGITDILSRPV---ATPN------------------SSLLS 72

  Fly   325 G--HVLGPAAAAAAAAGLPPHAAQFMPNPGMARDSYQLYPWLLSRHGRIFPHR-----------F 376
            |  ||.|       ..||......:.|..|.           .|:.|..:|.|           :
  Rat    73 GYPHVAG-------FGGLSSQGVYYGPQVGS-----------FSKTGNEYPTRTRNCWADTGQDW 119

  Fly   377 PGSF---------LVPPFRKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQV 432
            .||.         |.....|.|..|..|:..|:..||..||..:|:.|.||..||.:|.::|:||
  Rat   120 RGSTRPCSNTPDPLSDTIHKKKHTRPTFTGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQV 184

  Fly   433 KVWFQNRRTKHKRMQQEDEK-------GGEGGSQRNMHNGSGDEDDDELIDMEMDECPSDEEHEL 490
            ||||||||||.::....:..       ||..|.:      :..|::|:..:..:|....||:..|
  Rat   185 KVWFQNRRTKWRKKSALEPSSSTPRAPGGASGDR------AASENEDDEYNKPLDPDSDDEKIRL 243

  Fly   491  490
              Rat   244  243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 27/51 (53%)
Nkx6-3NP_001102925.1 Homeobox 143..197 CDD:395001 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.