DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and NKX3-2

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001180.1 Gene:NKX3-2 / 579 HGNCID:951 Length:333 Species:Homo sapiens


Alignment Length:67 Identity:36/67 - (53%)
Similarity:44/67 - (65%) Gaps:2/67 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 PPFRKP--KRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKR 445
            |...||  ||.|.|||.:|:.:||..|...:|:.|.||..||.:|.|:|||||:||||||.|.||
Human   199 PAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKR 263

  Fly   446 MQ 447
            .|
Human   264 RQ 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649 30/55 (55%)
NKX3-2NP_001180.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..113
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 138..212 6/12 (50%)
Homeodomain 207..263 CDD:459649 30/55 (55%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.