DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and CG34367

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster


Alignment Length:73 Identity:32/73 - (43%)
Similarity:44/73 - (60%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 KPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQEDE 451
            |.:|.||.|:..||.:||..||...|.....|:.|:|.|.|||.:|:|||||||.|.::.:.:..
  Fly   191 KQRRSRTNFTLDQLNELERLFEETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKHENQMH 255

  Fly   452 KGGEGGSQ 459
            ||...||:
  Fly   256 KGFLVGSR 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649 27/55 (49%)
CG34367NP_001097140.1 Homeodomain 193..249 CDD:459649 27/55 (49%)
OAR 392..410 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.