DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and hoxc11b

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_009298848.2 Gene:hoxc11b / 570925 ZFINID:ZDB-GENE-000822-3 Length:306 Species:Danio rerio


Alignment Length:91 Identity:31/91 - (34%)
Similarity:47/91 - (51%) Gaps:14/91 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 GSFLVPPFRKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTK 442
            |....|..||.   |..::..|:.:||..|..|.|:...:|..|::.|||::.|||:||||||.|
Zfish   227 GHSTTPRMRKK---RCPYTKFQIRELEREFFFNVYINKEKRLQLSRILNLTDRQVKIWFQNRRMK 288

  Fly   443 HKRMQQEDEKGGEGGSQRNMHNGSGD 468
            .|::           |:..:|..||:
Zfish   289 EKKL-----------SRDRLHYFSGN 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649 22/55 (40%)
hoxc11bXP_009298848.2 None

Return to query results.
Submit another query.