DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and Emx1

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_575584.5 Gene:Emx1 / 500235 RGDID:1564002 Length:290 Species:Rattus norvegicus


Alignment Length:311 Identity:107/311 - (34%)
Similarity:131/311 - (42%) Gaps:90/311 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 PAQRIQPPHTP-PKSVSPQSS-------QPSSSPTLLISS--------------------PHATP 230
            |.....|.|.. |::..|.||       ||::.....|.|                    |.|..
  Rat     8 PRTAAAPGHRAFPRAPLPHSSSAAATMFQPATKRGFTIESLVAKDGGTGGSPGSGGAGSHPLAVA 72

  Fly   231 PQQQQQQPPP-NYPKPAMMHPGGAGPMMMPGMPPAGLVRPFPMGPGGPPMPQGQPGLPDIKALPP 294
            ..::..:|.. |||     ||..|....:.|.|.|..........|||.:           ..|.
  Rat    73 ASEEPLRPTALNYP-----HPSAAETAFVSGFPAAAAAGASRSLYGGPEL-----------VFPE 121

  Fly   295 YINAPPELPPQHNPHLIAAAQFQMAAALQAGHVLGPAAAAAAAAGLPPH---AAQFMPNPGMARD 356
            .:|.|                   |..:...|.||.::..      |||   :||.       ||
  Rat   122 AMNHP-------------------ALTVHPAHQLGSSSLQ------PPHSFFSAQH-------RD 154

  Fly   357 SYQLYPWLLSRHGRIFPHRF-------PGSFLVPPF-RKPKRIRTAFSPSQLLKLEHAFESNQYV 413
            ....|||:|  ..|.|.|||       .|..|..|| ||||||||||||||||:||.|||.|.||
  Rat   155 PLHFYPWVL--RNRFFGHRFQASEVPQDGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYV 217

  Fly   414 VGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQEDEKGGEGGSQRNMHN 464
            ||||||.||.:|:||||||||||||||||:||.:.|:|.......::..|:
  Rat   218 VGAERKQLAGSLSLSETQVKVWFQNRRTKYKRQKLEEEGPESEQKKKGSHH 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 43/51 (84%)
Emx1XP_575584.5 COG5576 141..>251 CDD:227863 71/124 (57%)
Homeobox 196..248 CDD:278475 43/51 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000921
OrthoInspector 1 1.000 - - mtm9028
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.770

Return to query results.
Submit another query.