DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and dlx2

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001008061.1 Gene:dlx2 / 493423 XenbaseID:XB-GENE-852891 Length:285 Species:Xenopus tropicalis


Alignment Length:309 Identity:77/309 - (24%)
Similarity:101/309 - (32%) Gaps:143/309 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 HTPPKSV-SPQSSQPSSSPTLLIS----SPHATPPQQQQQQPPPNYPKPAMMHPGGAGPMMMPGM 261
            |.|..|. |...||  .||||.:|    |.:.|..||||.              .|||       
 Frog    16 HMPSSSYHSLHKSQ--ESPTLPVSTATDSSYYTNQQQQQH--------------CGAG------- 57

  Fly   262 PPAGLVRPFPMGPGGPPMPQGQPGLPDIKALPPYINAPPELPPQHNPHLIAAAQFQMAAALQAGH 326
                             .|.||.|                           :.||.         
 Frog    58 -----------------SPYGQLG---------------------------SYQFH--------- 69

  Fly   327 VLGPAAAAAAAAGLPPHAAQFMPNPGMARDSYQL-YPWLLSRHGRIFPHRFPGSFLVPPFR---- 386
                   .||..|:           ..:..||.| |....|.:|   |:   |:...||..    
 Frog    70 -------GAALNGI-----------SYSTKSYDLTYSGSYSSYG---PY---GTSPSPPHNDPEK 110

  Fly   387 ------------KPKRI---RTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWF 436
                        |||::   ||.:|..||..|:..|:..||:...||..||.:|.|::||||:||
 Frog   111 EDCEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWF 175

  Fly   437 QNRRTKHKRMQQEDEKGGEGGSQRNMHNGSGDEDDDEL-IDMEMDECPS 484
            ||||:|.|:|.:                 ||:...|:| :..|...|.|
 Frog   176 QNRRSKFKKMWK-----------------SGEIPSDQLPVGSESPTCNS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 26/51 (51%)
dlx2NP_001008061.1 DLL_N 29..107 CDD:315147 34/177 (19%)
Homeobox 130..183 CDD:306543 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.