DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and MSX1

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_002439.2 Gene:MSX1 / 4487 HGNCID:7391 Length:303 Species:Homo sapiens


Alignment Length:303 Identity:80/303 - (26%)
Similarity:117/303 - (38%) Gaps:85/303 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LSPETEQPQMAVSLKRERS----PAPPAMEQAENPAQRIQPPHTPPKSVSPQSSQPSSSPTLL-- 222
            ::|..:...:.:.:|.|.|    ||.....||.:.|...    ........:.::|..||:||  
Human     1 MAPAADMTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAAT----AAAMGADEEGAKPKVSPSLLPF 61

  Fly   223 ----ISSPHATPPQQQQQQPPPNYPKPAMMHPGGAGPMMMPGMPPAGLVRPFPMGPGGPPMPQGQ 283
                :.:.|..|..::....|....:.|   .|.|.|:   |:||..|                 
Human    62 SVEALMADHRKPGAKESALAPSEGVQAA---GGSAQPL---GVPPGSL----------------- 103

  Fly   284 PGLPDIKALPPYINAPPELPPQHNPHLIAAAQFQMAAALQAGHVLGPAAAAAAAAGLPPHAAQFM 348
             |.||..:.|        .|..|         |.:...|:                ||..|....
Human   104 -GAPDAPSSP--------RPLGH---------FSVGGLLK----------------LPEDALVKA 134

  Fly   349 PNPGMARDSYQLYPWLLSRHGRIFPHRFPGSFLVPP---FRKPK---RIRTAFSPSQLLKLEHAF 407
            .:|    :..:..||:.|  .|..|.  |...|.||   .||.|   :.||.|:.:|||.||..|
Human   135 ESP----EKPERTPWMQS--PRFSPP--PARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKF 191

  Fly   408 ESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQED 450
            ...||:..|||...:.:|:|:|||||:||||||.|.||:|:.:
Human   192 RQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAE 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 28/51 (55%)
MSX1NP_002439.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..55 7/40 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 69..117 16/79 (20%)
PTZ00449 <105..>248 CDD:185628 54/171 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 133..174 13/48 (27%)
Homeobox 175..229 CDD:395001 28/53 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.