DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and emx1

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001005459.1 Gene:emx1 / 448058 XenbaseID:XB-GENE-920144 Length:233 Species:Xenopus tropicalis


Alignment Length:259 Identity:98/259 - (37%)
Similarity:122/259 - (47%) Gaps:58/259 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 QPSSSPTLLISSPHATPPQQQQQQPPPNYPKPAMMHPGGAGPMMMPGMPPAGLVRPFPMGPGGPP 278
            ||:......|.|..|.......::|    .:||        .:..||.|....|..|| .|.|..
 Frog     3 QPAGKRCFTIESLVAKDNPLSSEEP----LRPA--------ALPYPGAPAEAFVSGFP-SPAGRS 54

  Fly   279 MPQGQPGLPDIKALPPYINAPPELPPQHNPHLIAAAQFQMAAALQAGHVLGPAAAAAAAAGLPPH 343
            :...    |:: ..|..::.||...   :||.:.|:..|        |               ||
 Frog    55 LYNN----PEL-VFPETVSHPPLTV---HPHQLGASHLQ--------H---------------PH 88

  Fly   344 AAQFMPNPGMARDSYQLYPWLLSRHGRIFPHRFPGS-------FLVPPF-RKPKRIRTAFSPSQL 400
            :. |.|   ..||....|||:|  ..|.|.|||.|.       .|..|| |||||||||||||||
 Frog    89 SF-FAP---QHRDPLNFYPWVL--RNRFFGHRFQGGDVSQESLLLHGPFARKPKRIRTAFSPSQL 147

  Fly   401 LKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQEDEKGGEGGSQRNMHN 464
            |:||.|||.|.||||||||.||.:|:||||||||||||||||:||.:.|:|.......::..|:
 Frog   148 LRLERAFEKNHYVVGAERKQLASSLSLSETQVKVWFQNRRTKYKRQKLEEEGPDSDQKKKGSHH 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 43/51 (84%)
emx1NP_001005459.1 COG5576 85..>194 CDD:227863 72/137 (53%)
Homeobox 139..192 CDD:365835 43/52 (83%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..233 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000921
OrthoInspector 1 1.000 - - mtm9445
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.