DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and dlx5

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001004778.1 Gene:dlx5 / 447997 XenbaseID:XB-GENE-853057 Length:289 Species:Xenopus tropicalis


Alignment Length:192 Identity:56/192 - (29%)
Similarity:85/192 - (44%) Gaps:58/192 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 PPQHNPHLIAAAQFQMAAALQAGHVLGPAAAAAAAAGLPPH------AAQFMPNPGMARDSYQL- 360
            |.|.:|.|      ..:.|..:|:.     :...|||.|.|      :|.:    |.|.::||. 
 Frog    24 PSQDSPTL------PESTATDSGYY-----SPGGAAGHPHHGYCSPTSATY----GKALNAYQYQ 73

  Fly   361 ----------YPW-LLSRHGRIFP----HRFPGSF--LVPPFR----------------KPKRI- 391
                      ||. ..|.:|...|    |::.|::  :.||..                |||:| 
 Frog    74 YHGMNGAAGNYPGKAYSDYGYGSPYHPHHQYSGAYNRVQPPSSQPEKEVSEPEVRMVNGKPKKIR 138

  Fly   392 --RTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQEDE 451
              ||.:|..||..|:..|:..||:...||..||.:|.|::||||:||||:|:|.|::.:..|
 Frog   139 KPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 25/51 (49%)
dlx5NP_001004778.1 DLL_N 26..118 CDD:315147 24/106 (23%)
Homeobox 140..193 CDD:306543 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.