DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and bap

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster


Alignment Length:340 Identity:76/340 - (22%)
Similarity:116/340 - (34%) Gaps:130/340 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 NAAMASGLS----------PLQTRLSPETEQPQMAVSLKRERSPAPPAMEQAENPAQRI--QPP- 201
            :|||| |||          .:.||.:|||.:....     :..|.|..::.:.:..:.|  .|| 
  Fly    10 SAAMA-GLSKSLTTPFSINDILTRSNPETRRMSSV-----DSEPEPEKLKPSSDRERSISKSPPL 68

  Fly   202 ---------HTPPKSVSPQSSQPSS----SPTLLISSPHATPPQQQQQQPPPNYPKPAMMHPGG- 252
                     .|.||.:.|.:.|||:    ....:.::.|.............:|.:..:.:.|. 
  Fly    69 CCRDLGLYKLTQPKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGST 133

  Fly   253 -AGPMMMPGMPPAGLVRPFPMGPGGPPMPQGQPGLPDIKALPPYINAPPELPPQHNPHLIAAAQF 316
             |.|:                     .|.:......|..:.||..::|.|.|..|:         
  Fly   134 LAAPL---------------------DMRRCTSNDSDCDSPPPLSSSPSESPLSHD--------- 168

  Fly   317 QMAAALQAGHVLGPAAAAAAAAGLPPHAAQFMPNPGMARDSYQLYPWLLSRHGRIFPHRFPGSFL 381
                                             ..|::|                          
  Fly   169 ---------------------------------GSGLSR-------------------------- 174

  Fly   382 VPPFRKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRM 446
                  .||.|.|||.:|:.:||..|...:|:.|.||..:|::|.|:|||||:||||||.|.||.
  Fly   175 ------KKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRK 233

  Fly   447 Q-QEDEKGGEGGSQR 460
            | |:.|....|.|:|
  Fly   234 QIQQHEAALLGASKR 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 27/51 (53%)
bapNP_732637.1 Homeobox 178..231 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.