DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and tin

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster


Alignment Length:447 Identity:112/447 - (25%)
Similarity:148/447 - (33%) Gaps:160/447 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 QSPPPGERNVPGSPPQTPPATLTLI---------PGSPPHHLMAPPAHGL----PYPHPHA---Q 99
            |||.||......:...||.:...::         .||..|...|..|..|    .|.:||.   .
  Fly    20 QSPSPGSLTNADALNTTPFSVKDILNMVNQTEAYEGSYGHIDGAATASALFAAGEYQNPHQYLNH 84

  Fly   100 QQHLQAPHPHPHLSPAQQHVLHQHLLMQQQHPGTPKSHQDIQELLQRLHHNAAMASGLSPLQTRL 164
            |||.|:..|.|     ||.:.|||                       |...|..:|.||||    
  Fly    85 QQHQQSELPIP-----QQQLHHQH-----------------------LDDGATTSSSLSPL---- 117

  Fly   165 SPETEQPQMAVSLKRERSPAPP-----AMEQAENPAQRIQPPHTPPKSVSPQSSQPSSSPTLLIS 224
                             .|.||     ..:....||...|..|..|.    ||.|.|:|...:.:
  Fly   118 -----------------LPPPPHQLYGGYQDYGMPAHMFQHHHGHPH----QSFQHSASAYNMSA 161

  Fly   225 SPHATPPQQQQQQPPPNYPKPAMMHPGGAGPMMMPGMPPAGLVRPFPMGPGGPPMPQGQPGLPDI 289
            |...........|.|..|    ..:..|:|.:.                 ||     ..|....|
  Fly   162 SQFYAGASATAYQTPATY----NYNYAGSGEVY-----------------GG-----ATPSAVGI 200

  Fly   290 KA--LP-PYINAPPEL-------------PPQH---NPHLIAAAQFQMAAALQAG---HVLGPAA 332
            |:  :| ||:...|.|             |.|.   ||    .:|..|..|..:.   .:.|...
  Fly   201 KSEYIPTPYVTPSPTLDLNSSAEVDSLQAPTQKLCVNP----LSQRLMETASNSSSLRSIYGSDE 261

  Fly   333 AA---------AAAAGLPPHAAQFMPNPGMARDSYQLYPWLLSRHGRIFPHRFPGSFLVPPFRKP 388
            .|         ::.:.|..::.....|||             |..|...|            |..
  Fly   262 GAKKKDNSQVTSSRSELRKNSISGNSNPG-------------SNSGSTKP------------RMK 301

  Fly   389 KRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKR 445
            ::.|..||.:|:|:||..|...:|:.||||:.:||.||||.||||:||||||.|.||
  Fly   302 RKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNRRYKSKR 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 30/51 (59%)
tinNP_524433.1 HOX 301..357 CDD:197696 30/55 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I4021
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.070

Return to query results.
Submit another query.