DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and CG15696

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster


Alignment Length:127 Identity:41/127 - (32%)
Similarity:68/127 - (53%) Gaps:14/127 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 PAA-AAAAAAGLPPHAAQFMPNPGMARDSYQLYPWLLSRHGRIFPHRFPGSFL--VPPFRKPKRI 391
            ||: .:..:.|.||.:|        |.....:|.||  ::.|..|.:.|.:..  .|..|.|.|:
  Fly    42 PASYVSKESGGSPPASA--------AEAQIPVYDWL--QYTRYHPPKLPRALRQNAPAKRTPGRL 96

  Fly   392 -RTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQEDEK 452
             |..|:|.||..||:|::.:.|:...:...||.:|.|:.|:||:||||||.:.:|.::|.::
  Fly    97 PRIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARERREKREKDE 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 22/51 (43%)
CG15696NP_650921.1 Homeobox 97..144 CDD:278475 18/46 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.