DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and nkx1.2lb

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_998713.1 Gene:nkx1.2lb / 407077 ZFINID:ZDB-GENE-040615-2 Length:373 Species:Danio rerio


Alignment Length:86 Identity:41/86 - (47%)
Similarity:54/86 - (62%) Gaps:7/86 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 KPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQ---- 447
            ||:|.||||:..||:.||:.|:|.:|:...||..||.:|:|:|||||:||||||||.|:..    
Zfish   226 KPRRARTAFTYEQLVALENKFKSTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGAD 290

  Fly   448 -QEDEKGGEGGSQRNMHNGSG 467
             .....||.||:  ...||.|
Zfish   291 TSAPTSGGGGGN--GPSNGLG 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649 31/55 (56%)
nkx1.2lbNP_998713.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..74
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..231 3/4 (75%)
Homeodomain 228..284 CDD:459649 31/55 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..328 9/31 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.